PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676714038
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family EIL
Protein Properties Length: 591aa    MW: 67474.6 Da    PI: 6.2575
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676714038genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3513.78.1e-157514351354
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                +el+krmw+d+m+lkrlke++ + +  ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+kv+
  676714038  51 DELEKRMWRDKMRLKRLKEQQSK-C--KEG-VDASKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVR 146
                79******************997.5..787.9******************************************************************** PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fdrngpaai+kyqa+n+i++g++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+ww++lgl++dqg+ppykkphd
  676714038 147 FDRNGPAAIAKYQAENNIVGGSNDCNSLVGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGKEEWWPQLGLPNDQGPPPYKKPHD 246
                *************************999************************************************************************ PP

                --HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX....XXXXXXXXXXXXXXXXXXXX..XXXXXX.XX CS
       EIN3 201 lkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss....slrkqspkvtlsceqkedve..gkkeskikh 294
                lkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee  +++++++s     s++ +s ++ +++ +++dve  +k+++ i +
  676714038 247 LKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEVVARELYPESCpllsSSSVGSGSLLINDCSEYDVEgfEKEQQPIFD 346
                ***************************************************************5545645556****************98888888999 PP

                XXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
       EIN3 295 vqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                v+++k +                               +f+++rkrk ++s+ + +   +   tc++ ++++s+ +l+f+d++s++++++
  676714038 347 VEERKPEIvmsmthptsfgigkmqqhfpvkqevmattgSFEFTRKRK-PNSDLNVMIMDRPGFTCENGRCPHSKINLGFQDRSSRDNHQM 435
                9999997799************************************9.77777777777788**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.8E-13051300No hitNo description
Gene3DG3DSA:1.10.3180.105.2E-75175310IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.7E-61179303IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MMMFNEMGMY GNMDFFSSTP LGEIDVCPLP QAEQDHPVVE DDYTDDEIDV DELEKRMWRD  60
KMRLKRLKEQ QSKCKEGVDA SKQRQSQEQA RRKKMSRAQD GILKYMLKMM EVCKAQGFVY  120
GIIPEKGKPV TGASDNLREW WKDKVRFDRN GPAAIAKYQA ENNIVGGSND CNSLVGPTPH  180
TLQELQDTTL GSLLSALMQH CDPPQRRFPL EKGVSPPWWP NGKEEWWPQL GLPNDQGPPP  240
YKKPHDLKKA WKVGVLTAVI KHMSPDIAKI RKLVRQSKCL QDKMTAKESA TWLAIINQEE  300
VVARELYPES CPLLSSSSVG SGSLLINDCS EYDVEGFEKE QQPIFDVEER KPEIVMSMTH  360
PTSFGIGKMQ QHFPVKQEVM ATTGSFEFTR KRKPNSDLNV MIMDRPGFTC ENGRCPHSKI  420
NLGFQDRSSR DNHQMVCPYR DNRLTYGAAS KFHMDEVKPL VVSQQSQTFA QSVQPIDLSG  480
YGVPENGQKM ITELMAMYDR NVQSNQVPNQ CVIVDSTATQ NHQEHQLSFN RNQMFMQQGS  540
SGIKLDNNRF QMVFDSTPFD MASFDYRDDW QAGVMEGMGK QQQQDVSSIW F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B1e-861783102134Protein ETHYLENE INSENSITIVE 3
4zds_A1e-861783102134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528650.0AK352865.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-14-H19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006408669.10.0hypothetical protein EUTSA_v10001938mg
SwissprotQ9SLH00.0EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLE4MWG80.0E4MWG8_EUTHA; mRNA, clone: RTFL01-14-H19
TrEMBLV4M5A10.0V4M5A1_EUTSA; Uncharacterized protein
STRINGBra000528.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.10.0ETHYLENE-INSENSITIVE3-like 1